Uruburuella suis: LVJ78_10525 Help Entry LVJ78_10525       CDS       T08067                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism usu  Uruburuella suis Pathway usu01100   Metabolic pathways usu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:usu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LVJ78_10525    00074 Mycolic acid biosynthesis     LVJ78_10525   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LVJ78_10525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UOO79115 UniProt:  A0AAE9GSD8 LinkDB All DBs Position 2315927..2316217 Genome browser AA seq 96 aa AA seqDB search MSYTFTLAPGALETELKRLILQETDKLDDFAPEAIGDDEPLFGDSSRVALDSLDALQISV ALQTHFQVRLQGDREVRRHMLNVRDLAAFVRASHSA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgagctacactttcaccctcgctcccggcgcgctcgaaaccgagcttaaacggctgatt ttgcaggaaaccgacaagcttgatgattttgcccccgaagccatcggcgatgatgagccg ctgtttggcgacagcagccgcgtggcgctcgattcgctggatgccctgcaaatttccgtg gcgctgcaaacgcattttcaggtgcggctgcaaggcgaccgcgaagtgcgccgccacatg ctcaatgtgcgcgacttagccgcctttgtgcgcgccagccacagcgcatga

DBGET integrated database retrieval system