Uruburuella suis: LVJ78_10910 Help Entry LVJ78_10910       CDS       T08067                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism usu  Uruburuella suis Brite KEGG Orthology (KO) [BR:usu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:usu03110]     LVJ78_10910 (groES)    03029 Mitochondrial biogenesis [BR:usu03029]     LVJ78_10910 (groES) Chaperones and folding catalysts [BR:usu03110]  Heat shock proteins   HSP10    LVJ78_10910 (groES) Mitochondrial biogenesis [BR:usu03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     LVJ78_10910 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  UOO79183 UniProt:  A0AAE9GWW0 LinkDB All DBs Position complement(2389406..2389693) Genome browser AA seq 95 aa AA seqDB search MTIRPLHDRVVVKRLEAEEKTASGIVLPGSAAEKPDMGEVIAVGAGKVGKDGQRRALDVK VGDKVIFGKYSGQAVKADGEELLVMREEDIFGIVE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaccattcgtcccctgcacgaccgtgtagttgtcaaacgcttggaagctgaagagaaa accgcctctggcatcgttttgccgggctcggccgctgaaaaacccgatatgggtgaagtg attgccgtgggcgcaggcaaagtcggcaaagacggccaacgccgcgcgctggatgtgaaa gtcggcgacaaagtgattttcggcaaatacagcggccaggccgtgaaagccgacggcgaa gagctgttggtaatgcgcgaagaagatattttcggcatcgtggaataa

DBGET integrated database retrieval system