Uruburuella testudinis: LVJ83_11280 Help Entry LVJ83_11280       CDS       T08135                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ute  Uruburuella testudinis Pathway ute01100   Metabolic pathways ute01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ute00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LVJ83_11280 (acpP)    00074 Mycolic acid biosynthesis     LVJ83_11280 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LVJ83_11280 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 HLH Motif Other DBs NCBI-ProteinID:  UOO81505 LinkDB All DBs Position complement(2461158..2461394) Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVNEAEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEEA EKITTVQLAIDYVQAHTA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaatattgaacaacaagttaaaaaaattgttgccgaacaactgggtgtgaatgaa gccgaagtgaaaaacgaatcttcattccaagatgatttgggcgctgattctctggatacc gttgagctggtaatggctttggaagaagccttcggctgcgaaatccccgacgaagaagcc gaaaaaatcaccaccgtgcagctggcaatcgactacgttcaggcacacaccgcttaa

DBGET integrated database retrieval system