KEGG   Variovorax sp. PAMC 28711: AX767_14070
Entry
AX767_14070       CDS       T04325                                 
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00770  Pantothenate and CoA biosynthesis
vaa01100  Metabolic pathways
vaa01240  Biosynthesis of cofactors
Module
vaa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AX767_14070
Enzymes [BR:vaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     AX767_14070
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig ANAPC5
Other DBs
NCBI-ProteinID: AMM25363
LinkDB
Position
2897895..2898398
AA seq 167 aa
MSSNVIAVYPGTFDPITLGHEDVVRRATQLFSKVIVAVAAGHHKKALFSLEERMEMAREA
AAPYSDQVTVESFSGLLRDFVVSRGGKAMVRGLRAVTDFDYEFQLAGMNRSLMPDVETVF
LTPSDKYQFISSTFVREIATLGGEVDKFVSPSVQEKLMAKVRSLNQA
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtccagcaacgtgatcgcggtttatcccggcacattcgatcccatcacgctcggccac
gaagacgtggtgcggcgtgcgacccagttgttttccaaggtgatcgtcgccgtcgcggcg
ggccaccacaagaaggcgctgttctcgctcgaagagcgcatggagatggcgcgcgaagcc
gccgcgccctacagcgaccaggtcacggtcgagagcttttccggcctgctgcgcgatttc
gtcgtgtcgcggggcggcaaggcgatggtccgcggcctgcgcgccgtgaccgacttcgac
tacgagttccagctggccggcatgaaccgttcgctgatgcccgacgtcgaaaccgtgttt
ctcacgcccagcgacaaataccagttcatctcgagcaccttcgtgcgggagatcgccacg
ctcggcggcgaagtcgacaagttcgtctcgcccagcgtgcaggaaaagctgatggccaag
gtgcgcagcctgaatcaggcttga

DBGET integrated database retrieval system