Variovorax sp. PAMC 28711: AX767_15080 Help Entry AX767_15080       CDS       T04325                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vaa  Variovorax sp. PAMC 28711 Pathway vaa01100   Metabolic pathways vaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AX767_15080    00074 Mycolic acid biosynthesis     AX767_15080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AX767_15080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  AMM25537 LinkDB All DBs Position 3113581..3113820 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAVDYATKNQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaaaatcattgccgaacaactcggcgtggaagag tcccaagtcaccaatgaaaaggctttcgtggccgacctcggtgccgactccctcgacacg gtcgaactcgtgatggcactcgaagacgagttcggcatcgagatcccggacgaagacgca gagaagatcaccacggtgcaaaacgccgtcgactacgccaccaagaatcaaaaggcctga

DBGET integrated database retrieval system