Variovorax sp. PAMC 28711: AX767_15685 Help Entry AX767_15685       CDS       T04325                                  Name (GenBank) exodeoxyribonuclease VII   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism vaa  Variovorax sp. PAMC 28711 Pathway vaa03430   Mismatch repair Brite KEGG Orthology (KO) [BR:vaa00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     AX767_15685  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:vaa03400]     AX767_15685 Enzymes [BR:vaa01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      AX767_15685 DNA repair and recombination proteins [BR:vaa03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      AX767_15685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S NBAS_11th Motif Other DBs NCBI-ProteinID:  AMM26823 UniProt:  A0A126ZI81 LinkDB All DBs Position 3242086..3242334 Genome browser AA seq 82 aa AA seqDB search MPKVPSPATSTPAALPASYEAGLQELEQLVAELESGQLPLDQLLGSYQRGAALLAFCRDK LQAVEDQIMVLDAGSLKVWAPE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcccaaggtgccttctcccgccacgtcaacgcctgccgcgctgcccgccagctacgaa gcggggctgcaggaactcgaacaactggtggccgaactcgagtcgggccagttgccgctc gaccagctgctcggcagctaccagcgcggggcggcattgctcgctttctgccgcgacaag ctgcaggcggtcgaagaccagatcatggtgctcgatgcaggcagcctgaaggtttgggca cccgaatga

DBGET integrated database retrieval system