Vulcanimicrobium alpinum: WPS_02080 Help Entry WPS_02080         CDS       T09508                                  Name (GenBank) hypothetical protein   KO K03676   glutaredoxin 3 Organism vab  Vulcanimicrobium alpinum Brite KEGG Orthology (KO) [BR:vab00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:vab03110]     WPS_02080 Chaperones and folding catalysts [BR:vab03110]  Protein folding catalysts   Protein disulfide isomerase    WPS_02080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_3 GST_N_2 Zn_ribbon_tTFIIB Redoxin Thioredoxin_4 Motif Other DBs NCBI-ProteinID:  BDE04932 UniProt:  A0AAN2C8V1 LinkDB All DBs Position 215995..216243 Genome browser AA seq 82 aa AA seqDB search MDLETLEPGRTVELYISPACPYCSAALKHFDARGVTYAVHDAQNDRAARDAMFRYTGGDP TVPAIVVDGVYVQSGWGSPPRG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggacctggaaacgctcgaacccggccgcaccgtggagctctacatctcgccggcctgt ccgtactgttccgccgcgctgaagcatttcgacgcgcgcggcgtcacctacgcggtccac gacgcgcagaacgaccgcgccgcgcgcgacgcgatgttccgctacaccggcggcgatccg accgtcccggcgatcgtcgtcgacggcgtctacgtgcagtcgggctggggctcaccgccc cgcggttga

DBGET integrated database retrieval system