Vulcanimicrobium alpinum: WPS_23320 Help Entry WPS_23320         CDS       T09508                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism vab  Vulcanimicrobium alpinum Pathway vab03430   Mismatch repair Brite KEGG Orthology (KO) [BR:vab00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     WPS_23320  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:vab03400]     WPS_23320 Enzymes [BR:vab01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      WPS_23320 DNA repair and recombination proteins [BR:vab03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      WPS_23320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Motif Other DBs NCBI-ProteinID:  BDE07056 UniProt:  A0AAN1XYL1 LinkDB All DBs Position complement(2282577..2282819) Genome browser AA seq 80 aa AA seqDB search MADDRSASFEGSLQRLEQIVKILESEEPDLERAVALYKEGRELVGRCEGLLKTAHAGIDA ANAAPARPVEDALDDDEIEI NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcggacgacagatcggcctcttttgaaggctcgctccagcggctcgaacagatcgtg aagatcctcgaatcggaagaacccgatctcgagcgcgccgtcgcgctgtacaaggaggga cgcgagctggtcggccgctgcgaaggtctgctgaagaccgcgcatgcggggatcgacgcc gccaacgccgcccccgcgcgtcccgtcgaggacgcgctcgatgacgacgaaatcgagatc tga

DBGET integrated database retrieval system