Verticillium alfalfae: VDBG_00138 Help Entry VDBG_00138        CDS       T02227                                  Name (RefSeq) DNA-directed RNA polymerase II   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism val  Verticillium alfalfae Pathway val03020   RNA polymerase val03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:val00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     VDBG_00138   09124 Replication and repair    03420 Nucleotide excision repair     VDBG_00138  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:val03021]     VDBG_00138    03400 DNA repair and recombination proteins [BR:val03400]     VDBG_00138 Transcription machinery [BR:val03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      VDBG_00138 DNA repair and recombination proteins [BR:val03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       VDBG_00138 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Cep57_MT_bd Motif Other DBs NCBI-GeneID:  9528563 NCBI-ProteinID:  XP_003008457 UniProt:  C9S8V4 LinkDB All DBs AA seq 75 aa AA seqDB search MHQHVLMAGYKIPHPNVSEMFIRVQTDGTITPKDAVTEVIKDLMKDFSHLAQEFIREYEL RRVVEARQHDQTNGQ NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgcaccagcacgtcctgatggccggctacaagatcccccatcccaacgtgtccgagatg ttcatccgcgtccagacagacggcacgatcactccgaaagacgccgtgacggaggtcatc aaggacctcatgaaggacttctcccacctcgcgcaggagttcatccgcgagtacgagctg cgccgcgtcgtcgaggcgcgccagcacgatcagacgaacggacagtag

DBGET integrated database retrieval system