Verticillium alfalfae: VDBG_02013 Help Entry VDBG_02013        CDS       T02227                                  Name (RefSeq) cell division control protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism val  Verticillium alfalfae Pathway val04145   Phagosome val04148   Efferocytosis val04620   Toll-like receptor signaling pathway val05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:val00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     VDBG_02013    04148 Efferocytosis     VDBG_02013  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     VDBG_02013  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     VDBG_02013  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:val04131]     VDBG_02013   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:val04147]     VDBG_02013    04031 GTP-binding proteins [BR:val04031]     VDBG_02013 Membrane trafficking [BR:val04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     VDBG_02013  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     VDBG_02013   Macropinocytosis    Ras GTPases     VDBG_02013  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     VDBG_02013 Exosome [BR:val04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    VDBG_02013   Exosomal proteins of other body fluids (saliva and urine)    VDBG_02013   Exosomal proteins of colorectal cancer cells    VDBG_02013   Exosomal proteins of bladder cancer cells    VDBG_02013 GTP-binding proteins [BR:val04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     VDBG_02013 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  9535615 NCBI-ProteinID:  XP_003007825 UniProt:  C9SC20 LinkDB All DBs AA seq 200 aa AA seqDB search MAQPGVQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVMVDGKPISLGL WDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKWYPEIDHHAPNIPIILVGT KLDLREDHGTLESLRQKRMEPVSYDQALVCAKEIRAHKYLECSALTQRNLKSVFDEAIRY FNAPRLWHCDNLLTRIPVPS NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggctcaaccaggtgttcagtctttgaagtgcgtcgtgaccggcgacggtgctgtcgga aagacttgcttgctcatctcctacacaacgaatgctttccctggtgaatacattcccaca gtctttgacaactactctgctagtgttatggtggacggcaagccaatcagcttgggactg tgggatactgccggtcaagaggattatgacaggctgcgacctctctcttacccccagact gacgtcttcctcatctgcttctccatcgtcagcccgccgtcattcgacaacgtcaaggcc aagtggtaccccgagattgaccatcacgcaccaaacattcccattatcctcgtcggcact aagctcgatcttcgggaggaccacggcaccctcgagtcgctgcgccagaagcgcatggag ccggtctcctacgaccaggccctggtgtgtgctaaggaaatcagggcgcacaagtacctc gagtgctccgcgctcacgcagaggaacctcaagagcgtctttgacgaggctatccggtat ttcaatgcgcctcgactctggcattgcgacaacttgctaactcggatcccagtgccgtct tga

DBGET integrated database retrieval system