Verticillium alfalfae: VDBG_03997 Help Entry VDBG_03997        CDS       T02227                                  Name (RefSeq) autophagy protein   KO K08341   GABA(A) receptor-associated protein Organism val  Verticillium alfalfae Pathway val04136   Autophagy - other val04138   Autophagy - yeast val04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:val00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     VDBG_03997    04136 Autophagy - other     VDBG_03997    04139 Mitophagy - yeast     VDBG_03997  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:val04131]     VDBG_03997    04121 Ubiquitin system [BR:val04121]     VDBG_03997    03029 Mitochondrial biogenesis [BR:val03029]     VDBG_03997 Membrane trafficking [BR:val04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     VDBG_03997 Ubiquitin system [BR:val04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    VDBG_03997 Mitochondrial biogenesis [BR:val03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     VDBG_03997 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  9532659 NCBI-ProteinID:  XP_003006044 UniProt:  C9SFA2 LinkDB All DBs AA seq 93 aa AA seqDB search MSSSARRWKSPTSPPSIRRSIWCPRDLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTA ALMSSIYEEHKDEDGFLYITYSGEKNFGDCETA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcatctgcgagaaggtggaaaagtccgacatcgccaccatcgataagaagaagt atctggtgcccgcgggacctgaccgtcggtcagttcgtctacgtcatccggaagcgtatc aagctctccccggagaaggccattttcatcttcgtcgatgaggtcctgccacccacggct gccttgatgagcagcatctacgaggagcacaaggacgaggacggcttcctctacattacc tactccggcgagaaaaacttcggcgactgcgagactgcttga

DBGET integrated database retrieval system