Verticillium alfalfae: VDBG_09728 Help Entry VDBG_09728        CDS       T02227                                  Name (RefSeq) mitogen-activated protein kinase   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism val  Verticillium alfalfae Pathway val04011   MAPK signaling pathway - yeast val04111   Cell cycle - yeast val04148   Efferocytosis val04517   IgSF CAM signaling val04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:val00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     VDBG_09728   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     VDBG_09728  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     VDBG_09728   09143 Cell growth and death    04111 Cell cycle - yeast     VDBG_09728  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     VDBG_09728  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:val01001]     VDBG_09728   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:val03036]     VDBG_09728   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:val04147]     VDBG_09728 Enzymes [BR:val01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      VDBG_09728 Protein kinases [BR:val01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    VDBG_09728 Chromosome and associated proteins [BR:val03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      VDBG_09728 Exosome [BR:val04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    VDBG_09728 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Motif Other DBs NCBI-GeneID:  9531913 NCBI-ProteinID:  XP_003000008 UniProt:  C9SXV3 LinkDB All DBs AA seq 160 aa AA seqDB search MSRSNAPNPSGSRKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDHS MFCLRTLREMKLLRYFNHENIISILDIQKPRGYDTFNEVYLIQELMETDMHRVIRTQDLS DDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLSTPTAT NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtcgcgcagcaacgctcctaatccctcgggatcccgcaagatctccttcaacgtcagc gagcagtacgacatccaggatgtcgtcggcgagggcgcctacggtgtcgtctgctcggcg atacacaagccttcgggccagaaggtcgccatcaagaagatcaccccgttcgaccactcc atgttctgtctgcggaccctgcgtgagatgaagcttctgaggtacttcaaccacgagaac atcatctccatcctcgacattcagaagccccgcggctacgacacgttcaatgaggtgtac ctcatccaggaactcatggagacggacatgcaccgcgtcatccgcacccaggacctctcc gatgaccactgccagtacttcatctaccagacgctgcgcgccctcaaggcgatgcactcg gccaacgtcctccaccgtgatctcaagccctcgaacctgctctcaacgccaactgcgacc tga

DBGET integrated database retrieval system