Variovorax paradoxus S110: Vapar_1847 Help Entry Vapar_1847        CDS       T00916                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism vap  Variovorax paradoxus S110 Pathway vap01100   Metabolic pathways vap01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vap00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Vapar_1847   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Vapar_1847 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ACS18497 UniProt:  C5CUR9 LinkDB All DBs Position 1:complement(1980037..1980279) Genome browser AA seq 80 aa AA seqDB search MSSLKELQDLIHEKYGIEPSKLDPNASMRETGGLDSLALAEFLFAIEDHFGITMPDEDAN IDTLNELAVLVDKVRAAKTA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagttcgctgaaggaattgcaggacctgatccacgagaagtacggtatcgaaccgtcc aagctcgaccccaacgcatcgatgcgcgaaaccggcgggctcgactcgctggcattggcc gagttcctgtttgccatcgaagaccacttcggcatcaccatgcccgatgaagacgccaac atcgacacgctgaacgaactcgcggtgctggtcgacaaggtcagggccgcgaagacagcg tga

DBGET integrated database retrieval system