Vigna angularis (adzuki bean): 108321303 Help Entry 108321303         CDS       T04660                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism var  Vigna angularis (adzuki bean) Pathway var03083   Polycomb repressive complex var04120   Ubiquitin mediated proteolysis var04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:var00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108321303    04120 Ubiquitin mediated proteolysis     108321303   09126 Chromosome    03083 Polycomb repressive complex     108321303  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:var04131]     108321303    04121 Ubiquitin system [BR:var04121]     108321303    03036 Chromosome and associated proteins [BR:var03036]     108321303 Membrane trafficking [BR:var04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     108321303 Ubiquitin system [BR:var04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      108321303    Cul7 complex      108321303 Chromosome and associated proteins [BR:var03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      108321303   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      108321303 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  108321303 NCBI-ProteinID:  XP_017408508 UniProt:  A0A0L9TCJ7 LinkDB All DBs Position 10:8096944..8099601 Genome browser AA seq 155 aa AA seqDB search MSSARKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVDAANPDDKPSEEDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcatcggcgaggaagatcaccctgaagagttccgacggggaggcgttcgaggtggac gaggcggtggcgctggagtcgcagacgataaagcacatgattgaggacgactgcgccgac agcggcatccctctccccaacgttaccagcaagatcctcgctaaagtcatcgagtactgc aaaaaacatgtcgatgccgccaatcccgacgacaaaccttctgaggaagatctcaaggcc tgggacgcggatttcgtcaaggtcgaccaggccacgctcttcgatctcatcctggctgcg aactacctgaacatcaagagcctgctggatcttacatgccagactgtagcagacatgatc aaggggaagactccagaggaaattcgcaagacctttaacattaagaatgacttcacccct gaggaagaagaggaagttcgtcgggaaaatcaatgggcatttgaatga

DBGET integrated database retrieval system