Vigna angularis (adzuki bean): 108331438 Help Entry 108331438         CDS       T04660                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism var  Vigna angularis (adzuki bean) Pathway var03083   Polycomb repressive complex var04120   Ubiquitin mediated proteolysis var04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:var00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108331438    04120 Ubiquitin mediated proteolysis     108331438   09126 Chromosome    03083 Polycomb repressive complex     108331438  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:var04131]     108331438    04121 Ubiquitin system [BR:var04121]     108331438    03036 Chromosome and associated proteins [BR:var03036]     108331438 Membrane trafficking [BR:var04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     108331438 Ubiquitin system [BR:var04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      108331438    Cul7 complex      108331438 Chromosome and associated proteins [BR:var03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      108331438   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      108331438 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Methyltransf_16 Motif Other DBs NCBI-GeneID:  108331438 NCBI-ProteinID:  XP_017421604 UniProt:  A0A0L9TPU0 LinkDB All DBs Position 1:22121442..22123131 Genome browser AA seq 155 aa AA seqDB search MASTKKITLKSSDGEAFEVDEIVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVEANSADEKPTEDELKAWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcatcaacaaagaagatcacgctgaagagttcggacggtgaagcgttcgaagtggat gagattgtggctctggagtcgcagacgataaagcatatgatagaggatgattgtgccgac agcggaattcctcttcccaatgtcacaagcaagatccttgcaaaggtaatcgagtactgc aagaagcacgttgaggccaatagtgctgatgaaaagcctactgaggatgagctcaaggca tgggatgctgatttcgtcaaggttgatcaggccacgctcttcgatctcattctggctgcg aattacctgaatatcaagaaccttttggaccttacatgccagactgtagctgacatgata aaggggaagactcctgaggaaattcgcaagacttttaacattaagaatgacttcacccct gaggaagaagaagaagttcgtagggaaaaccaatgggcgtttgaatga

DBGET integrated database retrieval system