KEGG   Variovorax sp. 38R: IG196_29150
Entry
IG196_29150       CDS       T10235                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
vav  Variovorax sp. 38R
Pathway
vav03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vav00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    IG196_29150 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vav03011]
    IG196_29150 (rplR)
Ribosome [BR:vav03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    IG196_29150 (rplR)
  Bacteria
    IG196_29150 (rplR)
  Archaea
    IG196_29150 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p Porphobil_deamC RIOX1_C_WH
Other DBs
NCBI-ProteinID: QOF82111
LinkDB
Position
complement(6274315..6274680)
AA seq 121 aa
MLTKKAQRLRRSRQTRIRIATQGVARLTVNRTNLHIYATVISDDGTKVIATASTAEAEVR
AALGASGKGGNAAAATAIGKRIAEKAKAAGVEKVAFDRAGFAYHGRVKALAEAAREAGLQ
F
NT seq 366 nt   +upstreamnt  +downstreamnt
atgttgaccaaaaaagcacagcgtcttcgccgctcgcgccagacccgcatccgcatcgcg
acgcagggcgtggcccgcctcacggtgaaccgcaccaacctgcacatctatgccaccgtc
atctccgacgacggcaccaaggtgatcgcaaccgcatcgaccgccgaagccgaagtgcgc
gcagcactgggcgcctcgggcaagggtggcaatgccgccgctgccaccgccatcggcaag
cgcatcgctgaaaaggcgaaggctgccggcgtcgagaaggtcgctttcgatcgcgcaggt
ttcgcctaccacggccgcgtcaaggcgctggccgaggcagcccgcgaagccggtctgcag
ttctaa

DBGET integrated database retrieval system