Variovorax sp. W6: SFB74_31660 Help Entry SFB74_31660       CDS       T11181                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism vaw  Variovorax sp. W6 Pathway vaw00261   Monobactam biosynthesis vaw01100   Metabolic pathways vaw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vaw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SFB74_31660  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vaw01008]     SFB74_31660 Polyketide biosynthesis proteins [BR:vaw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SFB74_31660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  XVK58638 LinkDB All DBs Position complement(6873432..6873653) Genome browser AA seq 73 aa AA seqDB search MSNPFDDKNGTFLVLVNDEGQHSLWPAFIDVPAGWKVALPSTDRAACSAYIEANWTDMRP RSLAAKDLDAAGA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgtttgacgacaagaacggcaccttcctggtgctggtgaacgacgaaggc cagcactcgctgtggccggcgttcatcgacgtgcccgccggctggaaggtggcgctgccc tccaccgacagggcggcctgcagcgcctatatcgaggcgaactggaccgacatgcgcccg cggtcgctggcggccaaggatctcgatgccgctggcgcatga

DBGET integrated database retrieval system