Variovorax sp. PAMC28562: H7F36_11500 Help Entry H7F36_11500       CDS       T10649                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vax  Variovorax sp. PAMC28562 Pathway vax01100   Metabolic pathways vax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vax00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H7F36_11500    00074 Mycolic acid biosynthesis     H7F36_11500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H7F36_11500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNK71900 LinkDB All DBs Position 2437323..2437598 Genome browser AA seq 91 aa AA seqDB search MTSTTLVRIASILEKDFHADPLLVLPSTALAELGLDSLALMEFVFAVEDEFELRIPEDRL DPREAGITLQRLCEVIDGLVAARPELSTKSK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt ttgacttcgacaaccctcgtccgtattgcatccattctcgaaaaagatttccatgccgac ccgctgcttgtactgccgtcgactgcgcttgctgaactcggcctggattcgctggcactc atggaattcgtcttcgcggtggaggacgagttcgaacttcgcattcctgaggatcgcctc gatccacgcgaggcgggcatcacgttgcagcgcttgtgcgaagtgatcgacgggttggtg gccgcaagaccagagctttcgacaaaatccaaatga

DBGET integrated database retrieval system