Verrucomicrobia bacterium IMCC26134: IMCC26134_06175 Help Entry IMCC26134_06175   CDS       T03830                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism vba  Verrucomicrobia bacterium IMCC26134 Pathway vba01100   Metabolic pathways vba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IMCC26134_06175    00074 Mycolic acid biosynthesis     IMCC26134_06175   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IMCC26134_06175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AKC83958 LinkDB All DBs Position 1653382..1653621 Genome browser AA seq 79 aa AA seqDB search MKSSPSLLSVVNQVLANKRRPAVAALAPDTRLREELGFDSLDLAELTVRLEEAFGVDIFA AGVVGTAGEIEARLPPERK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaagtcctctccctctctactttccgtcgtcaatcaggttctcgctaacaaacgccgg cctgccgtggctgcgctagcacctgacacgagactccgcgaggagctgggctttgattcg ctcgatctcgccgagttgaccgtgcgactcgaggaggccttcggcgtggatatttttgcg gcaggcgtggtgggcacggcgggggaaatcgaggcgaggctgcctcccgaaaggaaatga

DBGET integrated database retrieval system