Nibricoccus aquaticus HZ-65: CMV30_05315 Help Entry CMV30_05315       CDS       T05426                                  Name (GenBank) hypothetical protein   KO K00939   adenylate kinase [EC:2.7.4.3] Organism vbh  Nibricoccus aquaticus HZ-65 Pathway vbh00230   Purine metabolism vbh00730   Thiamine metabolism vbh01100   Metabolic pathways vbh01110   Biosynthesis of secondary metabolites vbh01232   Nucleotide metabolism vbh01240   Biosynthesis of cofactors Module vbh_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP Brite KEGG Orthology (KO) [BR:vbh00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     CMV30_05315   09108 Metabolism of cofactors and vitamins    00730 Thiamine metabolism     CMV30_05315  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vbh04147]     CMV30_05315 Enzymes [BR:vbh01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.3  adenylate kinase      CMV30_05315 Exosome [BR:vbh04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    CMV30_05315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ADK AAA_17 Motif Other DBs NCBI-ProteinID:  ATC66004 UniProt:  A0A290QBV2 LinkDB All DBs Position complement(1269815..1270183) Genome browser AA seq 122 aa AA seqDB search MNQLRSLNIEHVSPVGLLRQEISRRTPFGLTAERLAQQGKPLAEDSTLALMRRWFWTRKP DAGFALSGFPATLLQAKVFDEWLDARDESLHGLIAADQSSEAVVDHYRALGLTVVETSAL AA NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaatcagctccgttctttgaatattgagcacgtctctcctgtcggccttctgcgacaa gagatttcgcgccgcacgccgttcggtctcaccgccgagcgacttgctcagcagggcaaa cccctcgctgaagattccacgctcgcgctcatgcgccgctggttctggacgcgcaaacct gatgcgggtttcgccctaagcggattcccggctacgctgctccaagcaaaagtattcgac gaatggctcgatgcccgcgacgaaagcctccacggccttatcgcagcggaccagtcatct gaagccgtcgtcgatcattaccgcgctctcggtctcacagttgttgagaccagcgcttta gcggcctga

DBGET integrated database retrieval system