KEGG   Nibricoccus aquaticus HZ-65: CMV30_17745
Entry
CMV30_17745       CDS       T05426                                 
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh00260  Glycine, serine and threonine metabolism
vbh00750  Vitamin B6 metabolism
vbh01100  Metabolic pathways
vbh01110  Biosynthesis of secondary metabolites
vbh01120  Microbial metabolism in diverse environments
vbh01230  Biosynthesis of amino acids
Module
vbh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMV30_17745
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CMV30_17745
Enzymes [BR:vbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CMV30_17745
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C
Other DBs
NCBI-ProteinID: ATC65638
UniProt: A0A290QJX4
LinkDB
Position
4381917..4383278
AA seq 453 aa
MRFISTRGQSPALGFSDAVATGLAPDGGLFLPETLPSFANDLKRFEKLSYPELCFEFLKV
FATDIPQETLRAIIAKSYTTFSHPDIAPLKQLSEKLHVLELFHGPTLAFKDFALQLLGNL
YEYQCRTRGETINVLGATSGDTGSAAIHGLLGKPGTAIFILYPDGRTSPLQERQMACTGA
ANVFALAIDGTFDDAQNALKDVFGDQDFRKQFRLSAVNSINLARVLAQCVYYLSAFLRLP
AAQREEAEFVVPTGNFGNVLAGWMLQKMGVPIRGFRVATNQNDILYRLFTTGEYAVSDVR
ASLAPSMDIQVASNFERFLYFNVGRDGAKVREVMQTFKTTGRYTFANFDKDSFDASRCTD
AEIPGIIKDVYRKYGYIADPHTACGFKDIKTDRPSVILSTASPAKFPETIIKAIGTEPTH
PSLEVLKAKPLVKHKIVADPATIKAFIREHAVR
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgcgtttcatttctactcgcggacaatctcctgctcttggtttcagcgacgccgttgcc
accgggctcgcgccggatggcgggttgtttctgcccgagactttgccgtcgtttgcgaac
gatctgaaacgcttcgagaaactgagctaccccgaactctgtttcgaattcctcaaggtc
ttcgcgaccgacatccctcaagaaacgctgcgcgcgatcatcgcgaaatcgtacacgacc
ttctcgcatcccgacatcgcaccgctgaaacagctcagcgaaaaactgcacgtcctcgaa
ctcttccacgggccgaccctcgcgttcaaagacttcgcgctccagctcctcggcaatctc
tacgaataccagtgccgcacgcgcggtgagacgatcaatgtcctcggcgccacctcgggc
gacaccggctccgctgcgatccacggcctgctcggtaaacccggcaccgcgattttcatc
ctctatcccgacggccgcacctcgccgcttcaggagcgccagatggcctgcaccggcgcg
gccaatgtcttcgccctcgcgatcgacggcaccttcgacgacgcgcagaacgcgttgaag
gacgtcttcggcgatcaggatttccggaagcaattccgcctctccgcggtgaactccatc
aatctcgcccgtgtgctcgcccagtgcgtgtactacttgagcgcgttcctccgtcttccc
gccgcgcagcgcgaagaggctgagttcgtcgtccccacgggtaattttggaaatgttctc
gccggctggatgctccagaaaatgggtgtgccgatccgcggcttccgcgtcgcgaccaat
cagaacgacattctctaccgcctcttcacgactggcgaatacgcagtgtccgacgtgcgt
gcgagtctcgcgccatcgatggacatccaggtcgcgtcgaacttcgagcgcttcctctat
ttcaacgttggccgcgacggcgcgaaagtccgcgaggtcatgcagactttcaagacgacc
ggtcgctacacgttcgcgaatttcgacaaggactccttcgacgcctcgcgctgcaccgat
gccgagattcctggcatcatcaaagatgtctaccggaagtacggctacatcgccgatccg
cacaccgcgtgcggcttcaaggacatcaagacggaccgcccgagtgtgattctctccacg
gcgagcccggcgaaattccccgagacgatcatcaaagccatcggcaccgagccgacgcac
ccgagtctcgaagtcctcaaagccaagccgctcgtgaagcacaagatcgtcgccgatccc
gccacgatcaaagccttcatccgcgagcacgcggtgcgctga

DBGET integrated database retrieval system