Kiritimatiella glycovorans: L21SP4_00346 Help Entry L21SP4_00346      CDS       T04225                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism vbl  Kiritimatiella glycovorans Brite KEGG Orthology (KO) [BR:vbl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vbl03032]     L21SP4_00346    03036 Chromosome and associated proteins [BR:vbl03036]     L21SP4_00346    03400 DNA repair and recombination proteins [BR:vbl03400]     L21SP4_00346 DNA replication proteins [BR:vbl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     L21SP4_00346 Chromosome and associated proteins [BR:vbl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     L21SP4_00346 DNA repair and recombination proteins [BR:vbl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       L21SP4_00346 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Motif Other DBs NCBI-ProteinID:  AKJ63627 UniProt:  A0A0G3EDY4 LinkDB All DBs Position complement(383915..384199) Genome browser AA seq 94 aa AA seqDB search MATPKTKTQIIAQMADDAEITKVQAKAALESMVDMAYKGAKTKDGFTIPGIGKLIKQRRK ARTGRNPATGESIKIPAKTVLKFRISKQAKDAIL NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctaccccgaaaacgaagacgcagatcatcgcacagatggctgacgacgccgagatc acgaaagttcaggccaaggccgcgctggaatccatggtggatatggcctacaagggcgcc aagaccaaagacggattcaccatccccggcatcgggaagctgatcaagcagcgccgcaaa gcccgcaccggccgcaatcccgccaccggcgaatcgattaagattccggccaagaccgtg ctgaagttccggatctccaagcaggccaaagacgccattctctga

DBGET integrated database retrieval system