Verrucomicrobia bacterium S94: EGM51_15045 Help Entry EGM51_15045       CDS       T05990                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism vbs  Verrucomicrobia bacterium S94 Brite KEGG Orthology (KO) [BR:vbs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vbs03032]     EGM51_15045    03036 Chromosome and associated proteins [BR:vbs03036]     EGM51_15045    03400 DNA repair and recombination proteins [BR:vbs03400]     EGM51_15045 DNA replication proteins [BR:vbs03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EGM51_15045 Chromosome and associated proteins [BR:vbs03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EGM51_15045 DNA repair and recombination proteins [BR:vbs03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EGM51_15045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding DUF7342 Motif Other DBs NCBI-ProteinID:  QBG48654 UniProt:  A0A4V0ZHG1 LinkDB All DBs Position complement(3413492..3413770) Genome browser AA seq 92 aa AA seqDB search MGKPMTKSQIIAAVAEKADISKAQAKDALEGLAELAYEGAADGFTIPGIGKLVKVERAAR QGRNPATGETIQIPAKTVLKFRIAKAAKDAVL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgggaaaacctatgaccaaatcgcaaatcatcgcagccgttgctgaaaaagcagatatt tctaaagctcaggccaaagacgccctcgaaggcctcgccgaactcgcatacgaaggtgcc gctgacggcttcaccatccccggcatcggcaaactggttaaagttgaacgtgctgcacgt cagggccgtaacccggctaccggtgaaaccattcagattccggctaaaaccgtgctgaaa ttccgcatcgcgaaagctgcaaaagacgcagtactctaa

DBGET integrated database retrieval system