Vanessa cardui (painted lady): 124534071 Help Entry 124534071         CDS       T09161                                  Name (RefSeq) bombyxin A-1 homolog   KO K04526   insulin Organism vcd  Vanessa cardui (painted lady) Pathway vcd04068   FoxO signaling pathway vcd04081   Hormone signaling vcd04140   Autophagy - animal vcd04150   mTOR signaling pathway vcd04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:vcd00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     124534071    04150 mTOR signaling pathway     124534071   09133 Signaling molecules and interaction    04081 Hormone signaling     124534071  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124534071  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     124534071  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vcd04052]     124534071 Cytokines and neuropeptides [BR:vcd04052]  Neuropeptides   Unclassified    124534071 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  124534071 NCBI-ProteinID:  XP_046965693 LinkDB All DBs Position 12:11672987..11673304 Genome browser AA seq 101 aa AA seqDB search MKPQTVLILFALSAFVATVTSQGYGEVYCGRRLSTVLALLCDNNLIKRSQPQFPSAQGVD VNWPWIAMHRARSMGRSKRQVVAECCDKPCTINELMSYCGN NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaagccacagaccgtactgatcctcttcgccttatcagcattcgtagcaacggtaact tcgcaaggttacggagaggtttactgtgggagaaggctgtcgacagttctagcacttctc tgcgataataatttgatcaagaggagtcagccgcagttcccgtctgcacagggcgtagac gtcaactggccgtggattgcaatgcacagagcacgcagcatgggcaggagtaagaggcag gtggtcgcggagtgctgtgacaagccttgcaccatcaacgaactcatgtcatactgcggc aactga

DBGET integrated database retrieval system