Vanessa cardui (painted lady): 124535023 Help Entry 124535023         CDS       T09161                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism vcd  Vanessa cardui (painted lady) Pathway vcd04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:vcd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124535023  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vcd04121]     124535023    03400 DNA repair and recombination proteins [BR:vcd03400]     124535023 Ubiquitin system [BR:vcd04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      124535023    Cul5 complex      124535023 DNA repair and recombination proteins [BR:vcd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124535023 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  124535023 NCBI-ProteinID:  XP_046966999 EnsemblRapid:  ENSVCAG00000005125 LinkDB All DBs Position 14:12886939..12893891 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVPPPSQMLFNKDSQLMEDEKTLAE YGLTSATAKAQCPAPIGLALRKENGEFETLELTQYSTPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattaggcgaaaaaaattgaccatcttcacagatgcgaaggat actacgactgttttagaattgaagaaaatgatagaaggtatcctgaaagtaccaccccca agtcagatgctattcaacaaggacagtcagctaatggaagatgaaaagaccctcgcagag tatggactaacttcggccacagctaaggctcagtgccccgctccgattggattggcttta cgaaaagaaaatggtgaatttgagactttggaactgacacagtactctacaccacccgat ctacctgatgtgatgaaatctcaggagaccaatggacaggaacagatggatcagcactaa

DBGET integrated database retrieval system