Vanessa cardui (painted lady): 124536079 Help Entry 124536079         CDS       T09161                                  Symbol Atg8 Name (RefSeq) autophagy related protein Atg8   KO K08341   GABA(A) receptor-associated protein Organism vcd  Vanessa cardui (painted lady) Pathway vcd04068   FoxO signaling pathway vcd04136   Autophagy - other vcd04137   Mitophagy - animal vcd04140   Autophagy - animal vcd04145   Phagocytosis vcd04156   Integrated stress response (ISR) signaling pathway Brite KEGG Orthology (KO) [BR:vcd00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     124536079 (Atg8)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     124536079 (Atg8)    04140 Autophagy - animal     124536079 (Atg8)    04136 Autophagy - other     124536079 (Atg8)    04137 Mitophagy - animal     124536079 (Atg8)   09143 Cell growth and death    04156 Integrated stress response (ISR) signaling pathway     124536079 (Atg8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vcd04131]     124536079 (Atg8)    04121 Ubiquitin system [BR:vcd04121]     124536079 (Atg8)    03029 Mitochondrial biogenesis [BR:vcd03029]     124536079 (Atg8) Membrane trafficking [BR:vcd04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     124536079 (Atg8) Ubiquitin system [BR:vcd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    124536079 (Atg8) Mitochondrial biogenesis [BR:vcd03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     124536079 (Atg8) SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 NRG4_TM Motif Other DBs NCBI-GeneID:  124536079 NCBI-ProteinID:  XP_046968470 LinkDB All DBs Position 16:7592660..7593417 Genome browser AA seq 116 aa AA seqDB search MKFQYKEEHSFEKRKTEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgaaattccaatataaagaagaacattcttttgagaagagaaagaccgagggcgaaaaa atacgcagaaaatatccagatcgcgttccagttattgtggagaaagcccctaaagctcgt ctgggagatctcgataaaaaaaagtatttggtgccatctgatttaaccgtgggccaattt tactttttgatcagaaaacggattcatctacgtcccgaagatgcattatttttttttgtt aacaacgtaatacctcccacttctgcaacaatgggctcgctgtatcaagaacatcacgat gaagactttttcctttacattgcattttccgatgaaaatgtttacggctaa

DBGET integrated database retrieval system