Vibrio cholerae O1 2010EL-1786: Vch1786_I2532 Help Entry Vch1786_I2532     CDS       T01650                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vce  Vibrio cholerae O1 2010EL-1786 Pathway vce01100   Metabolic pathways vce01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vce00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Vch1786_I2532    00074 Mycolic acid biosynthesis     Vch1786_I2532   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Vch1786_I2532 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF7215 Motif Other DBs NCBI-ProteinID:  AET28095 LinkDB All DBs Position 1:2679773..2680015 Genome browser AA seq 80 aa AA seqDB search MVYMSISEEKIINLIAGILEVEIGIINKELAVGDIPEWDSLAHMRIIAALESDLGVVLDI EQVLEIEDVEDIIDAVINNE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtttatatgtctatctctgaagaaaaaattatcaatcttattgcaggaattcttgaa gtagaaattggtattattaataaagaacttgccgttggtgatatccctgaatgggactcg ttagctcacatgagaataattgcggctcttgaatcggatttgggagtagttttggatatc gaacaagttcttgaaatagaagatgttgaagatattatcgatgctgtaattaataacgag taa

DBGET integrated database retrieval system