Vibrio cholerae O1 El Tor FJ147: IR04_06165 Help Entry IR04_06165        CDS       T03827                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vcf  Vibrio cholerae O1 El Tor FJ147 Pathway vcf01100   Metabolic pathways vcf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vcf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IR04_06165    00074 Mycolic acid biosynthesis     IR04_06165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IR04_06165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7215 DUF7080 Motif Other DBs NCBI-ProteinID:  AJZ98778 LinkDB All DBs Position I:254518..254751 Genome browser AA seq 77 aa AA seqDB search MSISEEKIINLIAGILEVEIGIINKELAVGDIPEWDSLAHMRIIAALESDLGVVLDIEQV LEIEDVEDIIDAVINNE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctatctctgaagaaaaaattatcaatcttattgcaggaattcttgaagtagaaatt ggtattattaataaagaacttgccgttggtgatatccctgaatgggactcgttagctcac atgagaataattgcggctcttgaatcggatttgggagtagttttggatatcgaacaagtt cttgaaatagaagatgttgaagatattatcgatgctgtaattaataacgagtaa

DBGET integrated database retrieval system