Vibrio cholerae O1 El Tor FJ147: IR04_17130 Help Entry IR04_17130        CDS       T03827                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism vcf  Vibrio cholerae O1 El Tor FJ147 Brite KEGG Orthology (KO) [BR:vcf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vcf03036]     IR04_17130 Chromosome and associated proteins [BR:vcf03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     IR04_17130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL YqiJ_N Motif Other DBs NCBI-ProteinID:  AKA00813 LinkDB All DBs Position I:complement(2663863..2664183) Genome browser AA seq 106 aa AA seqDB search MPRQSPPNLAKLIALDLLTVGRVPLLLLVLIFSCAMGVVFMTHHTRQAISAKDQAFMERE RLDNEWRNLILEETALAEHSRVQQLARKDLEMKRPDSDKEVVINLK NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgcctcgtcagtcgccgccgaacctcgcgaagttaattgccctcgatctactgacggta ggtcgggtgcccttgctgcttttagtgctgatttttagctgcgctatgggcgtggtgttt atgactcaccatactagacaggcgatcagtgctaaagatcaagcctttatggagcgtgag cggctcgataacgaatggcgcaacctgattttggaagaaactgctttggctgagcacagc cgagtacaacaattagcaagaaaagatctggagatgaaacgtccagattcagacaaagaa gtcgtgatcaaccttaaatga

DBGET integrated database retrieval system