Vibrio cholerae O1 El Tor N16961: VC_0527 Help Entry VC_0527           CDS       T00034                                  Name (GenBank) conserved hypothetical protein   KO K05589   cell division protein FtsB Organism vch  Vibrio cholerae O1 El Tor N16961 Brite KEGG Orthology (KO) [BR:vch00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vch03036]     VC_0527 Chromosome and associated proteins [BR:vch03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     VC_0527 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC MENTAL Motif Other DBs NCBI-ProteinID:  AAF93695 UniProt:  Q9KUJ3 LinkDB All DBs Position I:559777..560067 Genome browser AA seq 96 aa AA seqDB search MVMRVFALTLSLLLVWLLYTLMWGKNGVMDFRAVQAEIEVQQQVNANLHLRNQEMFAEID DLRQGLDAIEERARNELGMVKDGETFYRIIGEESRQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ttggttatgcgagtatttgctttgaccctaagcctgctattggtctggctgctttatacc ctgatgtggggcaaaaacggtgtgatggattttcgcgctgtacaagcggaaattgaagtg cagcagcaggtgaatgccaaccttcacctacgcaaccaagagatgtttgctgaaattgat gacctgcgccaagggctagatgcgattgaagagcgtgcccgtaacgaattgggtatggtc aaagatggagaaaccttctatcgcatcatcggtgaggagtcgcgccaatga

DBGET integrated database retrieval system