Vibrio cholerae O1 El Tor N16961: VC_1842 Help Entry VC_1842           CDS       T00034                                  Name (GenBank) conserved hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism vch  Vibrio cholerae O1 El Tor N16961 Pathway vch00190   Oxidative phosphorylation vch01100   Metabolic pathways vch02020   Two-component system Module vch_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:vch00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     VC_1842  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     VC_1842 Enzymes [BR:vch01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      VC_1842 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB PsbW Motif Other DBs NCBI-ProteinID:  AAF94990 UniProt:  Q9KR05 LinkDB All DBs Position I:complement(1981577..1981684) Genome browser AA seq 35 aa AA seqDB search MWYFAWILGVLLACAFGIINALWLEHTEMMDKDSE NT seq 108 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggatccttggcgtattactcgcctgtgcattcggcatcatcaat gctctttggttagagcacactgagatgatggataaagatagtgagtga

DBGET integrated database retrieval system