Vibrio cholerae O1 IEC224: O3Y_01605 Help Entry O3Y_01605         CDS       T01766                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism vci  Vibrio cholerae O1 IEC224 Pathway vci02024   Quorum sensing vci03018   RNA degradation vci05111   Biofilm formation - Vibrio cholerae Brite KEGG Orthology (KO) [BR:vci00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     O3Y_01605 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     O3Y_01605 (hfq)    05111 Biofilm formation - Vibrio cholerae     O3Y_01605 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vci03019]     O3Y_01605 (hfq)    03036 Chromosome and associated proteins [BR:vci03036]     O3Y_01605 (hfq) Messenger RNA biogenesis [BR:vci03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      O3Y_01605 (hfq) Chromosome and associated proteins [BR:vci03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     O3Y_01605 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AFC57208 LinkDB All DBs Position I:370161..370424 Genome browser AA seq 87 aa AA seqDB search MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS TVVPARPVSHHSGDRPASDRPAEKSEE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctctacaagacccatttctgaatgcactacgtcgtgaacgtatc cctgtttctatctaccttgtgaacggcattaaactgcaaggtcagatcgaatcatttgat caatttgtgatcttgctgaagaacacagtaaaccaaatggtttacaagcatgcgatttct actgtggttcctgctcgtccagttagccaccacagcggcgaccgcccagcatcggatcgt ccagcagagaagtctgaagagtaa

DBGET integrated database retrieval system