Vibrio cholerae O1 IEC224: O3Y_02490 Help Entry O3Y_02490         CDS       T01766                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism vci  Vibrio cholerae O1 IEC224 Brite KEGG Orthology (KO) [BR:vci00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vci03036]     O3Y_02490 (ftsB) Chromosome and associated proteins [BR:vci03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     O3Y_02490 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC MENTAL Motif Other DBs NCBI-ProteinID:  AFC57381 LinkDB All DBs Position I:559446..559730 Genome browser AA seq 94 aa AA seqDB search MRVFALTLSLLLVWLLYTLMWGKNGVMDFRAVQAEIEVQQQVNANLHLRNQEMFAEIDDL RQGLDAIEERARNELGMVKDGETFYRIIGEESRQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgcgagtatttgctttgaccctaagcctgctattggtctggctgctttataccctgatg tggggcaaaaacggtgtgatggattttcgcgctgtacaagcggaaattgaagtgcagcag caggtgaatgccaaccttcacctacgcaaccaagagatgtttgctgaaattgatgacctg cgccaagggctagatgcgattgaagagcgtgcccgtaacgaattgggtatggtcaaagat ggagaaaccttctatcgcatcatcggtgaggagtcgcgccaatga

DBGET integrated database retrieval system