Vibrio cholerae O1 MJ-1236: VCD_001369 Help Entry VCD_001369        CDS       T00903                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vcj  Vibrio cholerae O1 MJ-1236 Pathway vcj01100   Metabolic pathways vcj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vcj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VCD_001369    00074 Mycolic acid biosynthesis     VCD_001369   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VCD_001369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7215 DUF7080 Motif Other DBs NCBI-ProteinID:  ACQ59538 LinkDB All DBs Position 1:complement(384239..384481) Genome browser AA seq 80 aa AA seqDB search MVYMSISEEKIINLIAGILEVEIGIINKELAVGDIPEWDSLAHMRIIAALESDLGVVLDI EQVLEIEDVEDIIDAVINNE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtttatatgtctatctctgaagaaaaaattatcaatcttattgcaggaattcttgaa gtagaaattggtattattaataaagaacttgccgttggtgatatccctgaatgggactcg ttagctcacatgagaataattgcggctcttgaatcggatttgggagtagttttggatatc gaacaagttcttgaaatagaagatgttgaagatattatcgatgctgtaattaataacgag taa

DBGET integrated database retrieval system