Vibrio chaetopteri: PG915_03050 Help Entry PG915_03050       CDS       T10904                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism vck  Vibrio chaetopteri Brite KEGG Orthology (KO) [BR:vck00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vck03036]     PG915_03050 (ftsB) Chromosome and associated proteins [BR:vck03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PG915_03050 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC KxDL Motif Other DBs NCBI-ProteinID:  XCD16553 UniProt:  A0AAU8BKL7 LinkDB All DBs Position 1:665772..666053 Genome browser AA seq 93 aa AA seqDB search MRIFTLVLLMVFSWLQYTLWFGKNGIVDFQQVDTEIQVQQQVNGNLQTRNDEMFAEIDDL RQGLDAIEERARHELGMIQQGETFYRIIGEDNQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcgtatcttcactcttgtgctgctaatggttttttcttggcttcaatacaccctctgg tttggaaaaaatggcattgttgatttccaacaagtggatacagaaatccaagtacagcaa caagttaatggcaacttacaaacccgcaacgatgaaatgtttgctgagattgacgatctt agacaagggttggatgccattgaagagcgagcgcgacatgagctaggaatgattcaacaa ggagaaaccttctaccgaatcataggtgaggataaccaatga

DBGET integrated database retrieval system