Vibrio chaetopteri: PG915_15485 Help Entry PG915_15485       CDS       T10904                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism vck  Vibrio chaetopteri Pathway vck02024   Quorum sensing vck03018   RNA degradation vck05111   Biofilm formation - Vibrio cholerae Brite KEGG Orthology (KO) [BR:vck00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PG915_15485 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PG915_15485 (hfq)    05111 Biofilm formation - Vibrio cholerae     PG915_15485 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vck03019]     PG915_15485 (hfq)    03036 Chromosome and associated proteins [BR:vck03036]     PG915_15485 (hfq) Messenger RNA biogenesis [BR:vck03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PG915_15485 (hfq) Chromosome and associated proteins [BR:vck03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PG915_15485 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  XCD15940 UniProt:  A0AAU8BHM9 LinkDB All DBs Position 1:complement(3378473..3378736) Genome browser AA seq 87 aa AA seqDB search MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS TVVPARAVSHHSGERTGGDRQQEKSED NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctcttcaagacccattcctaaatgcactacgtcgcgagcgtatc ccagtttctatctacctagtgaatggcatcaagctacaaggtcagattgaatcgtttgat cagtttgtgatccttctgaaaaatactgtaaaccaaatggtttacaagcatgcgatttca acggttgttccagcccgtgctgttagccatcacagtggtgagcgtactggcggcgaccgt caacaagagaaatctgaagattaa

DBGET integrated database retrieval system