Vibrio cholerae O1 LMA3984-4: VCLMA_A0219 Help Entry VCLMA_A0219       CDS       T01871                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism vcl  Vibrio cholerae O1 LMA3984-4 Pathway vcl01100   Metabolic pathways vcl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vcl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VCLMA_A0219    00074 Mycolic acid biosynthesis     VCLMA_A0219   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VCLMA_A0219 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7215 DUF7080 Motif Other DBs NCBI-ProteinID:  AEA77534 LinkDB All DBs Position I:237507..237740 Genome browser AA seq 77 aa AA seqDB search MSISEEKIINLIAGILEVEIGIINKELAVGDIPEWDSLAHMRIIAALESDLGVVLDIEQV LEIEDVEDIIDAVINNE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctatctctgaagaaaaaattatcaatcttattgcaggaattcttgaagtagaaatt ggtattattaataaagaacttgccgttggtgatatccctgaatgggactcgttagctcac atgagaataattgcggctcttgaatcggatttgggagtagttttggatatcgaacaagtt cttgaaatagaagatgttgaagatattatcgatgctgtaattaataacgagtaa

DBGET integrated database retrieval system