Volvox carteri f. nagariensis: VOLCADRAFT_106291 Help Entry VOLCADRAFT_106291 CDS       T01330                                  Name (RefSeq) hypothetical protein   KO K03012   DNA-directed RNA polymerase II subunit RPB4 Organism vcn  Volvox carteri f. nagariensis Pathway vcn03020   RNA polymerase vcn03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:vcn00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     VOLCADRAFT_106291   09124 Replication and repair    03420 Nucleotide excision repair     VOLCADRAFT_106291  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:vcn03021]     VOLCADRAFT_106291    03400 DNA repair and recombination proteins [BR:vcn03400]     VOLCADRAFT_106291 Transcription machinery [BR:vcn03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      VOLCADRAFT_106291 DNA repair and recombination proteins [BR:vcn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       VOLCADRAFT_106291 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb4 GGA_N-GAT Motif Other DBs NCBI-GeneID:  9624192 NCBI-ProteinID:  XP_002954202 JGI:  106291 UniProt:  D8U6D7 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MALPKQAMAQADAKVFEHAAVISNSEVATILSEYMRQRREEKPSFQPQPLVQKTLEYVQK FNCGTNPEAVQAMRNYMENFGLKPFEWGLIANLMPEDTDEANKLIPSLVDNPDDPPEEHR GFLPEELDRMLAELQNLRHA NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcgctcccaaagcaggcgatggctcaagcggatgctaaagtcttcgagcatgcggca gtcattagcaactcggaagtagcgacaatcctcagtgaatacatgcgccagcggagagag gagaagccctctttccagcctcagcccctggtgcagaagacgctggaatacgtccagaaa ttcaactgcgggactaaccctgaggccgtgcaggccatgagaaactacatggagaacttc ggtttgaagcccttcgagtggggccttatcgccaacctgatgccggaagacacggacgag gccaacaagctcatacccagcctggtggacaacccggatgacccgcccgaggagcaccgg ggcttcctgcccgaggaactggaccgcatgctggcggagctgcagaacctacgacacgca tga

DBGET integrated database retrieval system