Volvox carteri f. nagariensis: VOLCADRAFT_34406 Help Entry VOLCADRAFT_34406  CDS       T01330                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism vcn  Volvox carteri f. nagariensis Pathway vcn04016   MAPK signaling pathway - plant vcn04070   Phosphatidylinositol signaling system vcn04075   Plant hormone signal transduction Brite KEGG Orthology (KO) [BR:vcn00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     VOLCADRAFT_34406    04070 Phosphatidylinositol signaling system     VOLCADRAFT_34406    04075 Plant hormone signal transduction     VOLCADRAFT_34406  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vcn01009]     VOLCADRAFT_34406   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vcn04131]     VOLCADRAFT_34406    03036 Chromosome and associated proteins [BR:vcn03036]     VOLCADRAFT_34406   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vcn04147]     VOLCADRAFT_34406 Protein phosphatases and associated proteins [BR:vcn01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      VOLCADRAFT_34406 Membrane trafficking [BR:vcn04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     VOLCADRAFT_34406 Chromosome and associated proteins [BR:vcn03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      VOLCADRAFT_34406 Exosome [BR:vcn04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    VOLCADRAFT_34406 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 EF-hand_9 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  9628280 NCBI-ProteinID:  XP_002958807 JGI:  34406 UniProt:  D8UJH8 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search DASDQVKFRDLFDSFDTDRSGTLEVGELAQLVSQLVPGVSAAEVRYVMAMLDSSGDGHVT QQEFLAAAK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt gacgcctcggatcaggtcaaattccgcgacctgttcgacagcttcgacaccgaccgcagc ggcacgctcgaggtgggcgagctggctcagctggtgtcgcagctggttcccggagtgagc gccgcggaggtgcgctacgtcatggccatgttggacagctccggagacggacacgtcacg cagcaggagttcctggcggcggcgaag

DBGET integrated database retrieval system