Volvox carteri f. nagariensis: VOLCADRAFT_35532 Help Entry VOLCADRAFT_35532  CDS       T01330                                  Name (RefSeq) hypothetical protein   KO K16465   centrin-1 Organism vcn  Volvox carteri f. nagariensis Brite KEGG Orthology (KO) [BR:vcn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vcn03036]     VOLCADRAFT_35532   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:vcn03037]     VOLCADRAFT_35532 Chromosome and associated proteins [BR:vcn03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     VOLCADRAFT_35532 Cilium and associated proteins [BR:vcn03037]  Motile cilia and associated proteins   Dynein arm    VOLCADRAFT_35532 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH AIF-1 EF-hand_9 EF_EFCAB10_C DUF1456 Motif Other DBs NCBI-GeneID:  9625194 NCBI-ProteinID:  XP_002948461 JGI:  35532 UniProt:  D8TQ34 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search KPKLSDEQKQQMKECFELMDQDGSGAIDAEELAAAFKLLGIKMKRAELAQLLAEVDHDGS GEVEYPEFLEIMTVTLQRLAEEDDGDK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt aaacccaaactttcggacgaacaaaaacagcaaatgaaggaatgcttcgagttgatggac caggacgggtccggcgcaatcgatgcagaggagttggccgctgcgttcaagctcctaggt attaaaatgaagcgggcggagcttgcgcagctgctggcagaagtggaccatgatggcagc ggcgaggttgaatatccagaattcctggaaattatgactgtcactctacagcgccttgcg gaagaggatgacggtgacaag

DBGET integrated database retrieval system