Volvox carteri f. nagariensis: VOLCADRAFT_47214
Help
Entry
VOLCADRAFT_47214 CDS
T01330
Name
(RefSeq) hypothetical protein
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
vcn
Volvox carteri f. nagariensis
Brite
KEGG Orthology (KO) [BR:
vcn00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
vcn03029
]
VOLCADRAFT_47214
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
vcn02000
]
VOLCADRAFT_47214
Mitochondrial biogenesis [BR:
vcn03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
VOLCADRAFT_47214
Transporters [BR:
vcn02000
]
Other transporters
Primary active transporters [TC:
3
]
VOLCADRAFT_47214
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
9626826
NCBI-ProteinID:
XP_002957341
JGI:
47214
UniProt:
D8UFC4
LinkDB
All DBs
Position
Unknown
AA seq
137 aa
AA seq
DB search
DHKREPCPDRILNDIGGAFAMGAVGGGIWHLIKGTKNSPSGYRMRGAIEAVRREGPRLGG
SFANWGLTFALFDCSLQYVRKKEDPWNAIGAGALTGGFLQLRFGLSSAAKSAAFGGFLLA
LIEGLGIALTKLTSPPP
NT seq
411 nt
NT seq
+upstream
nt +downstream
nt
gatcacaaacgcgagccgtgcccagaccgcatcttgaatgatatcggtggtgccttcgcc
atgggagccgtgggcggcggcatctggcacctgataaaaggaactaaaaacagcccttca
ggctatcgaatgcggggagccatagaggccgtgcgccgggagggcccccgtctgggcggc
agtttcgccaactggggcctcaccttcgccctcttcgactgctccctgcagtacgtcaga
aagaaggaggacccttggaacgccattggcgcgggggcgctcacgggcggcttcctgcag
ctccggttcgggctgtcctccgcagctaagagtgcggcgtttggcggcttcctgctggcc
ctgattgaggggttgggtattgccctcacgaagctcacctcgcctccgccc
DBGET
integrated database retrieval system