Volvox carteri f. nagariensis: VOLCADRAFT_56004 Help Entry VOLCADRAFT_56004  CDS       T01330                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism vcn  Volvox carteri f. nagariensis Brite KEGG Orthology (KO) [BR:vcn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:vcn03041]     VOLCADRAFT_56004   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vcn04052]     VOLCADRAFT_56004 Spliceosome [BR:vcn03041]  Complex B   Other components    Complex B specific factors     VOLCADRAFT_56004 Cytokines and neuropeptides [BR:vcn04052]  Neuropeptides   Unclassified    VOLCADRAFT_56004 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  9617789 NCBI-ProteinID:  XP_002946472 JGI:  56004 UniProt:  D8TJM7 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPDKIRIQKWYTIYKDHITLADY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggttgttcttaacgatcgcttggggaaaaaggttcgagtcaagtgcaacgag gatgacaccatcggggacctcaaaaagctggtggcggcgcaaacagggacacggcccgat aagatccgcatccagaagtggtacaccatctacaaggaccacatcacactagccgactat gagatccacgacggcatgggtctggagctatactataactga

DBGET integrated database retrieval system