Volvox carteri f. nagariensis: VOLCADRAFT_60417 Help Entry VOLCADRAFT_60417  CDS       T01330                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism vcn  Volvox carteri f. nagariensis Pathway vcn04145   Phagocytosis vcn04517   IgSF CAM signaling vcn04814   Motor proteins Brite KEGG Orthology (KO) [BR:vcn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     VOLCADRAFT_60417  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     VOLCADRAFT_60417   09142 Cell motility    04814 Motor proteins     VOLCADRAFT_60417  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:vcn03037]     VOLCADRAFT_60417    04812 Cytoskeleton proteins [BR:vcn04812]     VOLCADRAFT_60417 Cilium and associated proteins [BR:vcn03037]  Motile cilia and associated proteins   Dynein arm    VOLCADRAFT_60417 Cytoskeleton proteins [BR:vcn04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      VOLCADRAFT_60417 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Dynactin Motif Other DBs NCBI-GeneID:  9619859 NCBI-ProteinID:  XP_002950440 JGI:  60417 UniProt:  D8TV49 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MAQQGVDEPQEQTGYQLQRQHYYKIITSYMPESFEQDAVQIALVAVDKYRQLKDIAFHIK HEYDKKYPGSGKATEGVYHCIVGKSFASAVSHETRQFIHMKVDTYHVILWKSKDTPFTAG AE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggcgcagcaaggagtcgatgagccacaggaacagactggatatcagctgcaaaggcaa cattattataaaatcatcacatcttacatgccggagagcttcgagcaggatgctgtgcaa atagcgctcgttgcggtcgataagtatcggcaactgaaggacatagcgttccacattaag cacgaatacgacaagaagtatccggggagcggaaaggcgacagagggggtctaccactgc attgtgggcaagagcttcgcaagtgctgtgagccacgaaacccggcaattcatccacatg aaggttgacacgtaccacgtaattctctggaagtcaaaggacacgcccttcaccgcggga gctgaatga

DBGET integrated database retrieval system