Volvox carteri f. nagariensis: VOLCADRAFT_74070 Help Entry VOLCADRAFT_74070  CDS       T01330                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism vcn  Volvox carteri f. nagariensis Pathway vcn03020   RNA polymerase vcn03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:vcn00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     VOLCADRAFT_74070   09124 Replication and repair    03420 Nucleotide excision repair     VOLCADRAFT_74070  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:vcn03021]     VOLCADRAFT_74070    03400 DNA repair and recombination proteins [BR:vcn03400]     VOLCADRAFT_74070 Transcription machinery [BR:vcn03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      VOLCADRAFT_74070   RNA polymerase III system    RNA polymerase III      VOLCADRAFT_74070   RNA polymerase I system    RNA polymerase I      VOLCADRAFT_74070 DNA repair and recombination proteins [BR:vcn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       VOLCADRAFT_74070 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  9616066 NCBI-ProteinID:  XP_002949114 JGI:  74070 UniProt:  D8TS01 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MIIPVRCFTCGKVIGNKWDTYLDLLQAGYSEQEALDGLGLSRYCCRRMLMTHVDLIEKLL NYNTLERSAQAQQRPGQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgattatccccgttcgctgcttcacctgtggaaaggtcatcggcaacaagtgggacacg tacttggatttgctacaagctggatacagtgaacaggaggctctagacggcttggggctt agccggtattgctgccgccgtatgcttatgacccacgtggacttgattgaaaagcttctg aattataataccttggagcgatcagcacaagcacagcagaggcctgggcagtaa

DBGET integrated database retrieval system