Volvox carteri f. nagariensis: VOLCADRAFT_80784 Help Entry VOLCADRAFT_80784  CDS       T01330                                  Name (RefSeq) hypothetical protein   KO K25829   transcription elongation factor 1 Organism vcn  Volvox carteri f. nagariensis Brite KEGG Orthology (KO) [BR:vcn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:vcn03400]     VOLCADRAFT_80784 DNA repair and recombination proteins [BR:vcn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      Other TCR factor       VOLCADRAFT_80784 SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_Elf1 Lar_restr_allev Zn_ribbon_PaaD Zn_ribbon_IS1595 DUF7837 YABBY_N Motif Other DBs NCBI-GeneID:  9616435 NCBI-ProteinID:  XP_002949656 JGI:  80784 UniProt:  D8TTJ6 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MGKRKGGSKPPPKKPRAKLDTLFSCPFCNSSKSVSVNFDRDMGRATAKCSQCSQKYESRC TPLTDAVDVYHDWLDSCEEANK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaaggaaaggcggctccaaaccgccacccaagaagccaagagccaagctagac acgttgttttcgtgtccattttgcaacagtagcaagtctgtatctgttaactttgatcgg gatatgggcagggcgaccgccaagtgctctcaatgtagccagaagtatgagagccgctgc acgcctttaacggatgctgttgatgtttatcatgattggcttgattcctgcgaggaggcc aacaagtga

DBGET integrated database retrieval system