Volvox carteri f. nagariensis: VOLCADRAFT_82285 Help Entry VOLCADRAFT_82285  CDS       T01330                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism vcn  Volvox carteri f. nagariensis Pathway vcn03020   RNA polymerase vcn03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:vcn00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     VOLCADRAFT_82285   09124 Replication and repair    03420 Nucleotide excision repair     VOLCADRAFT_82285  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:vcn03021]     VOLCADRAFT_82285    03400 DNA repair and recombination proteins [BR:vcn03400]     VOLCADRAFT_82285 Transcription machinery [BR:vcn03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      VOLCADRAFT_82285   RNA polymerase III system    RNA polymerase III      VOLCADRAFT_82285   RNA polymerase I system    RNA polymerase I      VOLCADRAFT_82285 DNA repair and recombination proteins [BR:vcn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       VOLCADRAFT_82285 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  9625856 NCBI-ProteinID:  XP_002953439 JGI:  82285 UniProt:  D8U403 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MARSQPILFEDVFDVVDKDPDGKKFDSVSRFICHSDLYEMDLHIDLNVELFPLQRNDKFS LVLAWTLNLDATPGSEKYDAFPAISGRRTLMDNYDYVMYGKVFKYKDNNMKVEVYISFGG LLMKLAGDPAKLEPIEVDSNVYLLLKKL NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcgcggagccaacctatccttttcgaagatgtatttgacgttgttgataaggaccct gatggcaagaaattcgacagcgtgtcccgcttcatctgccatagcgatctgtacgagatg gatcttcacattgacttaaacgtggaactgttcccacttcaacgaaacgataagttcagc ctggttctcgcgtggacgctcaacttggatgcgacgccggggagcgaaaagtacgatgcg ttcccggccatcagcgggcgccgtactctcatggacaattacgattacgtgatgtacggc aaagtgttcaagtacaaggacaacaacatgaaggttgaagtgtacatctccttcgggggt ctgttgatgaagctcgcgggcgaccctgccaagctggaaccgattgaggtggacagcaac gtttacttgctgctcaaaaaactataa

DBGET integrated database retrieval system