Vibrio cholerae O1 O395: VC0395_A2628 Help Entry VC0395_A2628      CDS       T00520                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism vco  Vibrio cholerae O1 O395 Pathway vco01100   Metabolic pathways vco01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vco00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VC0395_A2628    00074 Mycolic acid biosynthesis     VC0395_A2628   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VC0395_A2628 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7215 DUF7080 Motif Other DBs NCBI-ProteinID:  ABQ21672 UniProt:  A0A0H3AKB0 LinkDB All DBs Position 2:2780908..2781150 Genome browser AA seq 80 aa AA seqDB search MVYMSISEEKIINLIAGILEVEIGIINKELAVGDIPEWDSLAHMRIIAALESDLGVVLDI EQVLEIEDVEDIIDAVINNE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtttatatgtctatctctgaagaaaaaattatcaatcttattgcaggaattcttgaa gtagaaattggtattattaataaagaacttgccgttggtgatatccctgaatgggactcg ttagctcacatgagaataattgcggctcttgaatcggatttgggagtagttttggatatc gaacaagttcttgaaatagaagatgttgaagatattatcgatgctgtaattaataacgag taa

DBGET integrated database retrieval system