Vibrio cholerae O1 2012EL-2176: EN18_06235 Help Entry EN18_06235        CDS       T03389                                  Name (GenBank) DNA polymerase III subunit psi   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism vcq  Vibrio cholerae O1 2012EL-2176 Pathway vcq03030   DNA replication vcq03430   Mismatch repair vcq03440   Homologous recombination Brite KEGG Orthology (KO) [BR:vcq00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     EN18_06235    03430 Mismatch repair     EN18_06235    03440 Homologous recombination     EN18_06235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vcq03032]     EN18_06235    03400 DNA repair and recombination proteins [BR:vcq03400]     EN18_06235 Enzymes [BR:vcq01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      EN18_06235 DNA replication proteins [BR:vcq03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      EN18_06235 DNA repair and recombination proteins [BR:vcq03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      EN18_06235 SSDB OrthologParalogGFIT Motif Pfam:  DNA_III_psi Motif Other DBs NCBI-ProteinID:  AIT28650 UniProt:  A0A0H6MLF0 LinkDB All DBs Position 1:80433..80840 Genome browser AA seq 135 aa AA seqDB search MLSSSHYLSAMDIQQWELIHPERLAGFQPRTQTLDHDCRLLLVANQPPQGAEILLLERIL KSFQLELSMVRYIAPIQLSQLAYTGLEWIWFAGCDPLSHQAQKQLHSPRLSDIDGNTQYR RALWQQICAHQGIAS NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgctttcttcttcacactatttgtccgcgatggacattcaacaatgggaattgatccat ccagagcgtttggccggatttcagccgcgcacacaaacgctggatcacgattgccgactc ttgttggtggccaatcaaccgccacaaggcgcggaaattctgttgctggagagaattctc aaaagctttcagcttgagctgtcgatggttcgctacatcgcaccgattcagctcagtcaa cttgcctatactggactcgagtggatctggtttgcgggctgcgatcccttatctcatcag gctcaaaaacagctgcattcaccgcggttgagtgacattgatggcaatactcaataccgc cgcgcgttgtggcagcaaatttgcgctcatcaaggaatcgcatcatga

DBGET integrated database retrieval system