KEGG   Vibrio cholerae O1 2012EL-2176: EN18_06825
Entry
EN18_06825        CDS       T03389                                 
Name
(GenBank) peptidase A8
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03060  Protein export
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_06825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vcq01002]
    EN18_06825
Enzymes [BR:vcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     EN18_06825
Peptidases and inhibitors [BR:vcq01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   EN18_06825
SSDB
Motif
Pfam: Peptidase_A8
Other DBs
NCBI-ProteinID: AIT28766
UniProt: A0A0H6CED4
LinkDB
Position
1:203972..204487
AA seq 171 aa
MSNSSLALKQSGLRWLWLALLVFIADITIKLIVMDNMGYGWANRIEVLPFFNLLYVHNYG
AAFSFLSDQEGWQRWLFTGIAFVVTGMLAYWMRRLPASDKWNNIAYALIIGGAVGNVFDR
IVHGFVVDYLDFYWGTYHWPAFNLADSTICIGAAMIILDGFRAKKSAPSQS
NT seq 516 nt   +upstreamnt  +downstreamnt
atgtcgaattcgtctctggctcttaaacaatctggattgcgctggctgtggctggcgctt
ctggtgttcattgctgacatcacgatcaagttaattgtgatggataacatgggctatggt
tgggcaaaccgtattgaggtgctgcctttctttaacctgctgtatgtgcataactatggc
gcggcttttagctttctgagcgatcaggaagggtggcagcgctggctatttacgggtatt
gcctttgtggtcaccggtatgctcgcttactggatgcgtcgtcttccggcgagtgataag
tggaacaatattgcttatgcgctgatcattggcggtgccgtgggcaatgtgtttgatcgc
atcgtgcatggttttgtggtcgattatctcgatttttactggggaacctaccactggcca
gcgttcaatttggccgacagtacgatctgtatcggcgcagcgatgattattctcgatggt
tttcgcgctaagaaaagtgcaccaagtcagtcttag

DBGET integrated database retrieval system