KEGG   Vibrio cholerae O1 2012EL-2176: EN18_16840
Entry
EN18_16840        CDS       T03389                                 
Name
(GenBank) cell division protein FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq02024  Quorum sensing
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_16840
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_16840
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EN18_16840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_16840
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_16840
SSDB
Motif
Pfam: SRP54 SRP54_N Zeta_toxin AAA_30 AAA_22 AAA_33 MeaB AAA_24 AAA_17 APS_kinase CbiA AAA_31 TrwB_AAD_bind ABC_tran AAA AAA_16 Thymidylate_kin DUF2075 YqeC MMR_HSR1 VirC1 Ploopntkinase3 Rad17 NTPase_1 MobB AAA_7 KTI12 ArsA_ATPase ATP_bind_1
Other DBs
NCBI-ProteinID: AIT30682
LinkDB
Position
1:complement(2416484..2417647)
AA seq 387 aa
MTEKKKRGLLSWLGFGDEEKSQTTATDTQTQDEPQSQADVEAVAIQTETALTETETETET
ETETETATVEPARIVEQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEEL
EEQLLIADVGMDTTSKIIANLTARASRQQLRDGEALYGLLKEEMAEILSQVEQPLVIDTE
KKPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP
VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDS
APHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRY
IGVGEKIDDLRPFATQEFIDALFSREE
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgacggaaaaaaagaagcgtggcttgttgtcatggcttggatttggtgacgaagagaaa
agccaaaccactgcaacggatactcaaacgcaggatgaaccacaaagccaagccgatgtt
gaagcggtggcgattcaaacggaaactgcgttaacagaaacagaaacagaaacagaaaca
gaaacagaaacagaaacagccacggttgaacctgcacgtattgttgaacaagagaaaccg
accgaaagcttctttgcgcgcttaaagcgcagtttgagccgcaccaaagcgaatattggc
gctggcttctttggcctgtttaaaggcaaaaagattgatgatgacctgttcgaagagctc
gaagaacaactgctgattgccgatgtcggcatggatacgaccagcaaaatcatcgctaat
ttgaccgccagagcttctcgccagcaactgcgtgatggggaagcgctgtacggtctgctg
aaagaagagatggccgagattctctctcaggtcgagcagccattggtgatcgacactgag
aaaaaaccttacgtgatcttgatggtgggcgtgaatggggtgggtaaaactaccacgatc
ggtaaactggctaaacagttccaagcgcaaggcaagaaagtgatgttggcagcgggcgat
accttccgtgctgcagcggttgagcagttgcaagtgtggggagagcgcaatcaagtgcct
gtcatcgctcagcatactggcgccgacagtgcctccgtcatttatgatgcgattgaagcg
gcgaaagcgcgcgggattgacgtggtgattgcggataccgcaggccgtctgcaaaacaaa
agtaacctgatggaagagctgcgcaagattgtgcgcgtgatgaagaagattgatgacagt
gcgccacatgaaatcatgttgacgctggatgcgggtaccggacaaaacgcgatcagtcag
gccaaattgtttagtgatgtagcgcccatcacgggcattaccttaactaagcttgatggc
accgctaaaggtggcgtgattttcgcgattgccgatcaattccagatcccaatccgttat
atcggtgtcggcgagaaaattgacgacttacgtccatttgcaacacaagagtttatcgac
gcgctatttagccgcgaagaataa

DBGET integrated database retrieval system